Zooplus.fr  |  Accessoires animaux, nourriture animaux, animalerie en ligne - zooplus
Low trust score  | 
zooplus – Animalerie en Ligne : nourriture & accessoires pour animaux. Grand choix et prix malins toute l’année ! Livraison offerte dès 39 € d’achats

Zooplus.fr Website Information

Website Ranks & Scores for Zooplus.fr

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:40,030
Majestic Rank Majestic Rank:250,264
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Whois information for zooplus.fr

Full Whois Lookup for Zooplus.fr Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Zooplus.fr. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

%% This is the AFNIC Whois server.
%% complete date format : DD/MM/YYYY
%% short date format : DD/MM
%% version : FRNIC-2.5
%% Rights restricted by copyright.
%% See https://www.afnic.fr/en/products-and-services/services/whois/whois-special-notice/
%% Use '-h' option to obtain more information about this service.
%% [2a01:7e00:0000:0000:f03c:91ff:fe84:f734 REQUEST] >> zooplus.fr
%% RL Net [##########] - RL IP [#########.]

domain: zooplus.fr
status: ACTIVE
hold: NO
holder-c: ZA809-FRNIC
admin-c: ZA808-FRNIC
tech-c: UDA139-FRNIC
zone-c: NFC1-FRNIC
nsl-id: NSL130416-FRNIC
registrar: united-domains AG
Expiry Date: 13/01/2018
created: 13/01/2006
last-update: 13/01/2017
source: FRNIC

ns-list: NSL130416-FRNIC
nserver: ns.udag.org
nserver: ns.udag.de
nserver: ns.udag.net
source: FRNIC

registrar: united-domains AG
type: Isp Option 1
address: Gautinger Strasse 10
address: 82319 STARNBERG
country: DE
phone: +49 8151 36867 0
fax-no: +49 8151 36867 77
e-mail: Login to show email
anonymous: NO
registered: 06/04/2004
source: FRNIC

nic-hdl: ZA809-FRNIC
contact: zooplus AG
address: Sonnenstrasse 15
address: 80331 Muenchen
country: DE
phone: +49 89950060
e-mail: Login to show email
united-domains AG
changed: 13/12/2016 Login to show email
obsoleted: NO
source: FRNIC

nic-hdl: ZA808-FRNIC
contact: zooplus AG
address: Sonnenstrasse 15
address: 80331 Muenchen
country: DE
phone: +49 89950060
e-mail: Login to show email
united-domains AG
changed: 13/12/2016 Login to show email
obsoleted: NO
source: FRNIC

nic-hdl: UDA139-FRNIC
contact: united-domains AG
address: Gautinger Str. 10
address: 82319 Starnberg
address: Bayern
country: DE
phone: +49 8151368670
fax-no: +49 81513686777
e-mail: Login to show email
united-domains AG
changed: 20/01/2016 Login to show email
obsoleted: NO
source: FRNIC

Who hosts Zooplus.fr?

Zooplus.fr is hosted by zooplus AG in Bayern, Munich, Germany, 80807.
Zooplus.fr has an IP Address of and a hostname of

Zooplus.fr Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:zooplus AG
Hosted Country:GermanyDE
Location Latitude:48.1374
Location Longitude:11.5755
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Zooplus.fr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 17 Jun 2015 22:52:13 GMT
Server: Apache
X-Frame-Options: SAMEORIGIN
Vary: User-Agent,Accept-Encoding
X-Powered-By: PHP/5.1.6
Wrapper: 60.57
Cache-Control: max-age=0
Expires: Wed, 17 Jun 2015 22:52:13 GMT
X-dynaTrace-JS-Agent: true
Content-Encoding: gzip
Content-Length: 21172
Content-Type: text/html; charset=utf-8

Need to find out who hosts Zooplus.fr?

Zooplus.fr Free SEO Report

Website Inpage Analysis for Zooplus.fr

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Zooplus.fr

each each itemseach items valueshortnameaffinityoiseauantiparasitairescomplments alimentairesles produitsvaluestandardpricetext valuereducedpricetextprescription dietspcialcanari perruche grandepaiementmeilleures ventesnourriture pourtraitementeukanubaaffinity advance veterinaryroyal canin veterinaryspcifiquesvaluestandardpricetext valuereducedpricetext valuepriceperunitpricetextproco poissoncochon dindeet nourriturespecificchatadvance veterinary dietsmdicalissgrceet chatoiseau chevalhillsdietschien et chattous les produitshills prescription dietoffres spciales nouveautsratcaninfriandisesprogrammeperruche grandeeach eachroyallessanabellechienfraisjuniorcroquettesmeilleurescomplmentspourpouleconcept for lifechevauxpour chatnouveautschien etprescriptiongerbillepro planaccessoires pouradvanceorijenvaluepriceperunitpricetext each eachperroquetalmovalueshortnameunedindepoissonadultet sachetsoffreschat croquettesvaluestandardpricetextlifeklein mittelmoncochonracesoucagealiments mdicalissbons plansalimentsventeskleinspecific veterinary dietitems valueshortnamevaluepriceperunitpricetextplanfriandises litirespecific veterinarygrograndeperruche perroquetvotregrande perruche perroquetoctodonanimalmittel groleplansjouetvotre panierpurina propanierfuretgrande perruchechien chat rongeurvaluereducedpricetext valuepriceperunitpricetext eachcoet accessoires pourhills scienceoiseauxle produitnourriture et accessoirestastevotre chienmittel1hyginebonuseach itemsvalueshortname valuestandardpricetext valuereducedpricetextplussachetsspciales nouveautschien chatvalueratingvaluehills science planpompevousgourmetvetcomplextoutes lescanarivirbac vetcomplexpoissonssoinduet accessoiresspcial racescanin veterinarypour votretous lesanimauxtbotes et sachetsconceptetadult seniorspcifiques pourcommandeconseilstransportpackboschfrais de livraisoneachmarqueschatsvirbaclitirechevalnourriture etlapinajoutnaturesuret nourriture pourvalueshortname valuestandardpricetextpoisson oiseau chevalmon zoopluscatgoriespour chien etdescanin veterinary dietveterinary dietrechercheroffertsvarklein mittel grotoussciencevaluepriceperunitpricetext eachaccessoiresdiet royalpurina pro planperruche grande perruche0xlivraisoncanari perruchetoilettagehills prescriptiontoutespurinaperruchevoshamsterchien croquettesdietaffinity advancerongeuralmo natureoffres spcialesitemschat rongeurzooplusadvance veterinarybonszooplus vouschiensspcialespour chevauxalimentairespour chienjunior adult0aveccadeauxbotesveterinaryseniorproduitpoisson oiseauveterinary dietsfiltrediet royal caninvaluereducedpricetext valuepriceperunitpricetextco poisson oiseauproduitsunjunior adult seniorroyal caninnourriturescience planbotes etvaluereducedpricetextamp

Longtail Keyword Density for Zooplus.fr

tous les produits14
valuestandardpricetext valuereducedpricetext valuepriceperunitpricetext6
each each items6
hills prescription diet5
royal canin veterinary5
each items valueshortname5
et accessoires pour5
canin veterinary diet5
pour chien et4
diet royal canin4
klein mittel gro4
botes et sachets4
valueshortname valuestandardpricetext valuereducedpricetext4
valuepriceperunitpricetext each each4
valuereducedpricetext valuepriceperunitpricetext each4
perruche grande perruche3
grande perruche perroquet3
junior adult senior3
chien et chat3
canari perruche grande3
frais de livraison3
chien chat rongeur3
nourriture et accessoires3
advance veterinary diets3
affinity advance veterinary3
et nourriture pour3
hills science plan3
purina pro plan3
poisson oiseau cheval3
co poisson oiseau3
concept for life3
specific veterinary diet3
offres spciales nouveauts3
les produits16
tous les15
royal canin14
offres spciales9
veterinary diet8
accessoires pour8
pour chien7
each items7
pro plan7
valuereducedpricetext valuepriceperunitpricetext6
valuestandardpricetext valuereducedpricetext6
chien et6
veterinary diets6
each each6
nourriture pour5
et accessoires5
votre panier5
hills prescription5
items valueshortname5
canin veterinary5
prescription diet5
diet royal4
aliments mdicaliss4
complments alimentaires4
botes et4
et sachets4
le produit4
toutes les4
valuepriceperunitpricetext each4
klein mittel4
meilleures ventes4
mittel gro4
almo nature4
valueshortname valuestandardpricetext4
poisson oiseau4
pour votre4
spciales nouveauts3
et chat3
cochon dinde3
perruche grande3
grande perruche3
perruche perroquet3
nourriture et3
zooplus vous3
canari perruche3
pour chevaux3
votre chien3
purina pro3
chat rongeur3
co poisson3
oiseau cheval3
bons plans3
chien chat3
mon zooplus3
spcifiques pour3
junior adult3
adult senior3
et nourriture3
chien croquettes3
virbac vetcomplex3
spcial races3
pour chat3
chat croquettes3
specific veterinary3
advance veterinary3
hills science3
science plan3
affinity advance3
friandises litire3

What are the nameservers for zooplus.fr?

Zooplus.fr Domain Nameserver Information

HostIP AddressCountry
server1-ns1.udagdns.net Germany
server1-ns2.udagdns.net Germany
server1-ns3.udagdns.net Germany

Zooplus.fr DNS Record Analysis DNS Lookup

zooplus.frNS259200Target: server1-ns3.udagdns.net
zooplus.frNS259200Target: server1-ns1.udagdns.net
zooplus.frNS259200Target: server1-ns2.udagdns.net
zooplus.frSOA1048576MNAME: ns1.udagdns.com
RNAME: hostmaster.united-domains.de
Serial: 2014100702
Refresh: 10800
Retry: 3600
Expire: 604800
zooplus.frMX3600Priority: 20
Target: mail06.secure-mx.de
zooplus.frMX3600Priority: 10
Target: mail05.secure-mx.de
zooplus.frTXT3600TXT: v=spf1 ip4: -all

Alexa Traffic Rank for Zooplus.fr

Alexa Search Engine Traffic for Zooplus.fr