Zsl.org  |  Zoological Society of London (ZSL) - UK Zoos & Animal Conservation
Low trust score  | 
The Zoological Society of London (ZSL) is a charity devoted to the worldwide conservation of animals and their habitats. Visit London Zoo and Whipsnade Zoo.

Zsl.org Website Information

Website Ranks & Scores for Zsl.org

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:144,295
Majestic Rank Majestic Rank:11,051
Domain Authority Domain Authority:75%
DMOZ DMOZ Listing:No

Whois information for zsl.org

Full Whois Lookup for Zsl.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Zsl.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: ZSL.ORG
Registry Domain ID: D2360174-LROR
Registrar WHOIS Server:
Registrar URL: http://www.networksolutions.com
Updated Date: 2017-06-21T18:58:35Z
Creation Date: 1996-12-10T05:00:00Z
Registry Expiry Date: 2026-12-09T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C2951914-LROR
Registrant Name: Zoological Society of London
Registrant Organization: Zoological Society of London
Registrant Street: Regents Park
Registrant City: London
Registrant State/Province:
Registrant Postal Code: NW1 4RY
Registrant Country: GB
Registrant Phone: +44.2074496410
Registrant Phone Ext:
Registrant Fax: +1.9999999999
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C2951914-LROR
Admin Name: Zoological Society of London
Admin Organization: Zoological Society of London
Admin Street: Regents Park
Admin City: London
Admin State/Province:
Admin Postal Code: NW1 4RY
Admin Country: GB
Admin Phone: +44.2074496410
Admin Phone Ext:
Admin Fax: +1.9999999999
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C2951914-LROR
Tech Name: Zoological Society of London
Tech Organization: Zoological Society of London
Tech Street: Regents Park
Tech City: London
Tech State/Province:
Tech Postal Code: NW1 4RY
Tech Country: GB
Tech Phone: +44.2074496410
Tech Phone Ext:
Tech Fax: +1.9999999999
Tech Fax Ext:
Tech Email: Login to show email
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-15T10:28:44Z

Who hosts Zsl.org?

Zsl.org is hosted by Rackspace Ltd. in England, London, United Kingdom, Wc2n 5r.
Zsl.org has an IP Address of and a hostname of

Zsl.org Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Rackspace Ltd.
Hosted Country:United KingdomGB
Location Latitude:51.5085
Location Longitude:-0.12574
Webserver Software:Not Applicable

HTTP Header Analysis for Zsl.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 13 Jul 2015 18:05:31 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Tue, 14 Jul 2015 18:05:31 GMT
Last-Modified: Mon, 13 Jul 2015 16:26:37 GMT
Cache-Control: public, max-age=86400
ETag: W/"1436804797"
Content-Language: en
X-UA-Compatible: IE=edge,chrome=IE7
Link:; rel="canonical",; rel="shortlink"
X-Generator: Drupal 7 (http://drupal.org)
X-RS-SERVERNAME: zsl-app-03
Access-Control-Allow-Origin: *
X-Forwarded-Proto: (null)
Vary: Accept-Encoding
CF-Cache-Status: HIT
Server: cloudflare-nginx
CF-RAY: 2056ea9d147f0610-LHR
Content-Encoding: gzip

Need to find out who hosts Zsl.org?

Zsl.org Free SEO Report

Website Inpage Analysis for Zsl.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Zsl.org

ustwitterbutlikenowyoutube facebookgardenfacebook twitteroneinvolvedpollutiongarden wildlifezsl rtusing0zsl whipsnadezoo bookwhipsnade zoomore zslget involvedwildlifeiftheyinstagramplan yourbehaviourzslwatercansociety of londonzoologicalspeciesdid youtheirbecomezsl london zoositedid you knowzsl zslscience conservationalsowhipsnadebird behaviourlargestfacebookzoo book ticketsyou canzoozoological societyout moreworldknowoursciencelearndidwildlondonuksticketsamptruelondonriversweektwitter instagramzoosenglandteamfind out morefind outlondonriversweek officialzsljulydayworkingofficialzslgetout more zslyouzsl whipsnade zooplanwereriversimportantsurviveacrossgreatanimalsbookyour daybook ticketsfindnewsfieldanimalyoutube facebook twitterworkyourseefacebook twitter instagramsocietyinformationconservationvaritsshopmonitormoreyou knowrtzsl londonprotectgiftbirdthamesfolloweventsfishparkouthealthyoutubesupportlondon zooupmakeplan your day

Longtail Keyword Density for Zsl.org

find out more21
zsl london zoo6
zsl whipsnade zoo5
out more zsl4
facebook twitter instagram3
did you know3
plan your day3
zoo book tickets3
youtube facebook twitter3
society of london3
find out22
out more21
zsl rt7
zsl london7
london zoo6
zsl whipsnade5
whipsnade zoo5
londonriversweek officialzsl4
plan your4
more zsl4
did you4
get involved4
facebook twitter4
you know3
twitter instagram3
your day3
you can3
garden wildlife3
youtube facebook3
science conservation3
zoological society3
zsl zsl3
zoo book3
bird behaviour3
book tickets3

What are the nameservers for zsl.org?

Zsl.org Domain Nameserver Information

HostIP AddressCountry
bas-a.bcc.ac.uk Kingdom United Kingdom
link-1.ts.bcc.ac.uk Kingdom United Kingdom

Zsl.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Zsl.org is a scam?