Zuji HK - Find & Book Cheap Flights, Hotel, Travel Packages & Car Hires

Safety: Low trust score
Year Founded: 0000
Global Traffic Rank: 44,776
Estimated Worth: $577,440
Category: Travel > Tourism

Zuji HK brings you cheaper hotels, flights and travel packages. Get greater discounts on car hires and travel insurance. Book now and fly out of Hong Kong.



Domain summary

Last updated
2015-06-29
Domain label
zuji
Domain extension
com.hk
Global Traffic Rank
44,776
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$577,440
Estimated daily income
$802
Estimated monthly income
$24,394

Rank summary

How is zuji.com.hk ranked relative to other sites:

Percentage of visits to zuji.com.hk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Zuji.com.hk registered?
A: Zuji.com.hk was registered 2021 years, 4 months, 2 weeks, 5 days, 9 hours, 46 minutes, 7 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Zuji.com.hk last updated?
A: The WHOIS entry was last updated 2021 years, 4 months, 2 weeks, 5 days, 9 hours, 46 minutes, 7 seconds ago on Monday, November 30, -0001.
Q: What are Zuji.com.hk's nameservers?
A: DNS for Zuji.com.hk is provided by the following nameservers:
  • udns1.ultradns.net
  • udns2.ultradns.net
Q: Who is the registrar for the Zuji.com.hk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Zuji.com.hk?
A: Zuji.com.hk ranks 44,776 globally on Alexa. Zuji.com.hk has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Zuji.com.hk each day?
A: Zuji.com.hk receives approximately 66,872 visitors and 401,232 page impressions per day.
Q: What IP address does Zuji.com.hk resolve to?
A: Zuji.com.hk resolves to the IPv4 address 204.74.99.100.
Q: In what country are Zuji.com.hk servers located in?
A: Zuji.com.hk has servers located in the United States.
Q: What webserver software does Zuji.com.hk use?
A: Zuji.com.hk is powered by Instart/nginx webserver.
Q: Who hosts Zuji.com.hk?
A: Zuji.com.hk is hosted by NeuStar, Inc. in United States.
Q: How much is Zuji.com.hk worth?
A: Zuji.com.hk has an estimated worth of $577,440. An average daily income of approximately $802, which is roughly $24,394 per month.

Zuji.com.hk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Zuji.com.hk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Zuji.com.hk

H1 Headings

1 :
  1. 3

H2 Headings

1 :
  1. 7

H3 Headings

1 :
  1. 0

H4 Headings

1 :
  1. 0

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

2 :

Total Images

24 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-39856141-2

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Zuji.com.hk

cache true varajaxsetup cache truesuccesschinausbelowjsonline cachescar hiredealsitemlinkurlfunction datasupportsuccess functiondealajaxsetupourholidayajaxloaderremove loader flightspecialsflightspecialshide dealsloadershow ajaxsetupnewdataitems dataitemslengthdatatype jsondealsloadershow ajaxsetupsjsonp jsoncallback datatypeweigh upformatjson jsonp jsoncallbackpricestrue var apiurldocument scriptcachesinsurancescriptbelow excludedata dataitems dataitemslengthkongexclude tax documentreadyfunctionapiurld stemplateddealsloadershow ajaxsetup cacheacrosstrip5000 successhong konghotelsjscffrenderedflightspecialsflights hotelshotelmycustomer supportlogoimageurljsoncallback datatypedatasingaporevar cffrenderedfjsbookingsflightspecials dealsloadertogglejsonp jsoncallbackajax urlhkcombine youraccommodationdcreateelementsshowtimeout 5000googletagcmdpushfunctionformatjson jsonpmoreflightspecials dealsloadertoggle itemsdealsloadertoggle itemsjson timeout 5000english hkpackagesdatatypeservicefindtopitemsajax url apiurltemplate var cffrenderedsuccess function dataif datadealsloadershowloader flightspecialshide dealsloadershowdatatype json timeoutdata formatjson jsonphireexpressapiurl datacache trueshow loader flightspecialshideloader flightspecials dealsloadertoggledocumentreadyfunctiontravelurl apiurl datacaches the templatezuji hongtrue varjsoncallback datatype jsonflightsinstanturl apiurljsoncallbackajaxsetup cachebelow exclude taxcheapexclude taxjson timeoutonlineprices belowformatjsonbookingfunctiondata formatjsonvideocontainerbookflightspecialshide dealsloadershowupdataitemslineif data dataitems0enjoytemplate varexcludeurldestinationsdata varhongidzuji hong kongyouvar2over1dealsloadertoggleremove loadertax documentreadyfunctiondata dataitemscarweighdeallinkurlifcombineloader flightspecialshideenglishoffersyourdatalayeramericanldocumentloader flightspecialsapiurl data formatjsonprices below excludeitemlinkurl itemlinkurlflightspecialshidezujishow loaderdgetelementsbytagnames0var apiurltaxtimeout 5000 success5000 success functiontimeoutairlinesamerican expressdataitemslength247 customercustomerfunction data vartrueremovejsonpcache

Longtail Keyword Density for Zuji.com.hk

KeywordsOccurences
zuji hong kong8
jsoncallback datatype json3
flight-specials deals-loadertoggle items3
loader flight-specials deals-loadertoggle3
remove loader flight-specials3
data dataitems dataitemslength3
if data dataitems3
template var cffrendered3
caches the template3
function data var3
success function data3
5000 success function3
timeout 5000 success3
json timeout 50003
datatype json timeout3
prices below exclude3
below exclude tax3
formatjson jsonp jsoncallback3
data formatjson jsonp3
apiurl data formatjson3
url apiurl data3
ajax url apiurl3
true var apiurl3
cache true var3
ajaxsetup cache true3
deals-loadershow ajaxsetup cache3
flight-specialshide deals-loadershow ajaxsetup3
loader flight-specialshide deals-loadershow3
show loader flight-specialshide3
exclude tax documentreadyfunction3
jsonp jsoncallback datatype3
hong kong11
zuji hong9
english hk4
car hire4
american express4
itemlinkurl itemlinkurl4
d s3
if data3
5000 success3
success function3
function data3
data var3
line caches3
template var3
var cffrendered3
loader flight-specials3
data dataitems3
dataitems dataitemslength3
remove loader3
json timeout3
flight-specials deals-loadertoggle3
deals-loadertoggle items3
weigh up3
247 customer3
timeout 50003
jsonp jsoncallback3
datatype json3
deals-loadershow ajaxsetup3
customer support3
flights hotels3
prices below3
below exclude3
exclude tax3
tax documentreadyfunction3
show loader3
loader flight-specialshide3
flight-specialshide deals-loadershow3
ajaxsetup cache3
jsoncallback datatype3
cache true3
true var3
var apiurl3
ajax url3
url apiurl3
apiurl data3
data formatjson3
formatjson jsonp3
document script3
combine your3
var19
zuji14
data12
hong12
function12
hotels11
kong11
your9
if8
itemlinkurl8
flights8
packages7
booking7
book7
travel7
airlines6
apiurl6
items6
up6
us6
loader6
more5
customer5
enjoy5
you5
true5
hotel5
s5
accommodation5
across4
documentreadyfunction4
show4
04
fjs4
deallinkurl4
deal4
js4
l4
id4
video-container4
top4
express4
logoimageurl4
english4
hk4
hire4
deals4
american4
car4
our3
deals-loadertoggle3
googletagcmdpushfunction3
over3
cheap3
trip3
offers3
weigh3
13
service3
remove3
destinations3
singapore3
china3
combine3
holiday3
flight-specials3
datalayer3
dataitemslength3
online3
below3
prices3
instant3
find3
insurance3
support3
bookings3
tax3
my3
script3
document3
dcreateelements3
dgetelementsbytagnames03
new3
d3
exclude3
flight-specialshide3
dataitems3
timeout3
cffrendered3
template3
caches3
line3
success3
23
json3
deals-loadershow3
datatype3
jsoncallback3
jsonp3
formatjson3
ajax3
cache3
ajaxsetup3
url3

Who hosts Zuji.com.hk?

Zuji.com.hk Hosting Provider Information

Hosted IP Address:204.74.99.100
Hosted Hostname:crs.ultradns.net
Service Provider:NeuStar, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:instart/nginx

Is "NeuStar, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
NeuStar, Inc.
0.2206%

HTTP Header Analysis for Zuji.com.hk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: instart/172
Content-Type: text/html; charset=utf-8
Content-Length: 15457
Connection: keep-alive
Date: Mon, 29 Jun 2015 14:36:14 GMT
Age: 5313
X-AspNet-Version: 4.0.30319
Content-Encoding: gzip
Cache-Control: private
x-instart-cache-id: 6:10232459620103457903
X-Instart-Request-ID: 6232705841668057620:YBA01-NPPRY24:1435593887:354

Zuji.com.hk Domain Nameserver Information

HostIP AddressCountry
udns1.ultradns.net 204.69.234.1
udns2.ultradns.net 204.74.101.1


Need to find out who hosts Zuji.com.hk?


Domain Registration (WhoIs) information for Zuji.com.hk

 -------------------------------------------------------------------------------
Whois server by HKIRC
-------------------------------------------------------------------------------
.hk top level Domain names can be registered via HKIRC-Accredited Registrars.
Go to https://www.hkirc.hk/content.jsp?id=280 for details.
-------------------------------------------------------------------------------


Domain Name: ZUJI.COM.HK

Domain Status: Active

Contract Version: Refer to registrar

Registrar Name: ASCIO TECHNOLOGIES INC. - DK BRANCH

Registrar Contact Information: Email: Login to show email
Phone: +45.33886100

Reseller:



Registrant Contact Information:

Company English Name (It should be the same as the registered/corporation name on your Business Register Certificate or relevant documents): DOMAIN MANAGEMENT LIMITED
Company Chinese name:
Address: 39/F GLOUCESTER TOWER THE LANDMARK
15 QUEEN'S RD CENTRAL 8050
Country: HK
Email: Login to show email
Name Commencement Date: 11-06-2001
Expiry Date: 22-08-2019
Re-registration Status: Complete


Administrative Contact Information:

Given name: IT
Family name: ADMIN
Company name: ZUJI TRAVEL PTY. LTD
Address: LEVEL 2, 509 ST KILDA ROAD MELBOURNE 3004 VIC
Country: AU
Phone: +61-398289550
Fax:
Email: Login to show email
Name: HK8527323T



Technical Contact Information:

Family name: CHANDLER
Company name: URIEL GROUP
Address: TBA HONG KONG 00 HONG KONG
Country: HK
Phone: +852-56969310
Fax:
Email: Login to show email
Servers Information:

GREG.NS.CLOUDFLARE.COM
RUTH.NS.CLOUDFLARE.COM


Status Information:

Domain Prohibit Status:


-------------------------------------------------------------------------------
The Registry contains ONLY .com.hk, .net.hk, .edu.hk, .org.hk,
.gov.hk, idv.hk. and .hk $domains.
-------------------------------------------------------------------------------

WHOIS Terms of Use
By using this WHOIS search enquiry service you agree to these terms of use.
The data in HKDNR's WHOIS search engine is for information purposes only and HKDNR does not guarantee the accuracy of the data. The data is provided to assist people to obtain information about the registration record of domain names registered by HKDNR. You agree to use the data for lawful purposes only.

You are not authorised to use high-volume, electronic or automated processes to access, query or harvest data from this WHOIS search enquiry service.

You agree that you will not and will not allow anyone else to:

a. use the data for mass unsolicited commercial advertising of any sort via any medium including telephone, email or fax; or

b. enable high volume, automated or electronic processes that apply to HKDNR or its computer systems including the WHOIS search enquiry service; or

c. without the prior written consent of HKDNR compile, repackage, disseminate, disclose to any third party or use the data for a purpose other than obtaining information about a domain name registration record; or

d. use such data to derive an economic benefit for yourself.

HKDNR in its sole discretion may terminate your access to the WHOIS search enquiry service (including, without limitation, blocking your IP address) at any time including, without limitation, for excessive use of the WHOIS search enquiry service.

HKDNR may modify these terms of use at any time by publishing the modified terms of use on its website.

Websites with Similar Names

Zuji.com.hk
Zuji HK - Find & Book Cheap Flights, Hotel, Travel Packages & Car Hires
Zuji.site
系统发生错误
Zuji.win
zuji.win -&nbspThis website is for sale! -&nbspzuji Resources and Information.
Zuji13.com
zuji13.com
Zujia8.com
Not Found

Recently Updated Websites

Madotheme.com (1 second ago.)Iranprnet.com (1 second ago.)Sophiabentley.com (2 seconds ago.)Doctordaylily.com (3 seconds ago.)Chpd2020.com (3 seconds ago.)Bkefi.online (3 seconds ago.)Lasvegaskim.com (3 seconds ago.)Majorcompare.com (4 seconds ago.)Femalefitnessacademy.online (4 seconds ago.)Aluguss.com (4 seconds ago.)Edgaravelar.com (4 seconds ago.)Yvonnelawphotography.com (4 seconds ago.)Vgenetx.com (5 seconds ago.)Infianamichiganpower.com (5 seconds ago.)Mentesalternas.com (5 seconds ago.)Aiwenshang.com (6 seconds ago.)Zalik.app (6 seconds ago.)Vtgaming.com (6 seconds ago.)Sensing-c.com (6 seconds ago.)Bottleshopmi.com (6 seconds ago.)602945.com (7 seconds ago.)Finleycontracting.com (7 seconds ago.)Insaatbolumu.com (7 seconds ago.)Kollevikcamping.se (8 seconds ago.)Btopofmind.com (8 seconds ago.)Tnt.media (8 seconds ago.)Udacha-365.site (8 seconds ago.)Sonderhealth.us (8 seconds ago.)Marpolo.com.ar (8 seconds ago.)Hbsmc.org (9 seconds ago.)

Recently Searched Keywords

planifierles (1 second ago.)ladie pour (4 seconds ago.)drsquoabonnement (5 seconds ago.)afficher les (7 seconds ago.)protection des données  (8 seconds ago.)offrons (9 seconds ago.)fonctions aucuns frais (11 seconds ago.)et envoi de-mails (13 seconds ago.)mobile de gestion (16 seconds ago.)mobilemenu liis-hover (18 seconds ago.)android et (20 seconds ago.)aufnehmen (21 seconds ago.)abonnement mensuel (23 seconds ago.)mybusi (25 seconds ago.)border 3px solid (25 seconds ago.)li a mobilemenuslide (32 seconds ago.)sarkariresult info (33 seconds ago.)une boutique (34 seconds ago.)urban loft orta sehpa (43 seconds ago.)mrbreadman2 (43 seconds ago.)porod ii (44 seconds ago.)payplug stripe lemonway (45 seconds ago.)印度oil  (47 seconds ago.)astrology tools (49 seconds ago.)votre boutique (51 seconds ago.)distribution connexion aux (54 seconds ago.)«mybusiness est la solution idéale pour se lancer dans le commerce en ligne, il est simple, rapide et ne requiert aucune connaissance approfondie en informatique (55 seconds ago.)mobilemenu lipageitemhaschildren (57 seconds ago.)ap1 irons (59 seconds ago.)crer une boutique (1 minute ago.)