Easysw.com β Website Analysis
Comprehensive traffic, valuation, and technical report for easysw.com
easysw.com has a global rank of #623,188 with an estimated 12 daily visitors. Based on current traffic levels, the domain is valued at approximately $11,233.
The site runs on a .com (commercial) domain with servers located in United States, primary IP address 163.114.216.49, an active HTTPS configuration. Its homepage is titled β Easy Software Productsβ.
easysw.com was first registered on 1995-01-10 through Name.com, Inc..
Users commonly reach easysw.com by searching for "easyswitch", "easyswim", "easyswift", "easysweep", "easyswap".
People searching for these terms often visit easysw.com:
easyswitcheasyswimeasyswifteasysweepeasyswapeasyswim tawaeasyswim portaleasyswing golfeasyswim logineasyswift login| SSL Certificate | Secure |
| Security Score | 0% |
| Strict-Transport-Security | β |
| Content-Security-Policy | β |
| X-Content-Type-Options | β |
| X-Frame-Options | β |
| X-XSS-Protection | β |
Based on our analysis, easysw.com implements HTTPS encryption and scores 0% on security headers. There is room for improvement in security configuration.
easysw.com is missing 5 of 5 recommended security headers (Strict-Transport-Security, Content-Security-Policy, X-Content-Type-Options, X-Frame-Options, X-XSS-Protection). This leaves visitors more exposed to browser-based attacks.
| Purchase/Sale Value | $11,233 |
| Daily Revenue | $8 |
| Monthly Revenue | $234 |
| Yearly Revenue | $2,808 |
| Daily Visitors | 12 |
All values are estimates based on publicly available traffic data.
easysw.com ranks #623,188 globally. While outside the top 100k, the site maintains an active presence with regular visitors.
These are the websites closest to easysw.com in global traffic ranking.
| Website | easysw.com |
| Domain Age | 1995-01-10 05:00:00 |
| TLD | .com |
| Hosting Location | United States |
| Primary IP | 163.114.216.49 |
Hosted in the United States, easysw.com benefits from low latency for North American visitors and proximity to major internet exchange points.
Registered in 1995, easysw.com is a veteran domain at 31+ years old. Long-established domains carry more trust with users and search engines.
easysw.com uses easyswitch, easyswim, easyswift, easysweep, easyswap in its technology stack.
| Host | Type | IP | Nameserver |
|---|---|---|---|
| easysw.com | A | 163.114.216.49 | ns2dfg.name.com. |
| easysw.com | A | 163.114.217.17 | ns3dgr.name.com. |
| easysw.com | A | 163.114.217.49 | ns4hmp.name.com. |
| easysw.com | A | 163.114.216.17 | ns1fkl.name.com. |
Connection
Content-Encoding
Content-Type
Date
Server
Set-Cookie
X-Powered-By
X-Request-Id
X-Rnd
| Registrar | Name.com, Inc. |
| Registered | 1995-01-10 05:00:00 |
| Status | Active |
Registered in 1995, easysw.com is a veteran domain at 31+ years old. Long-established domains carry more trust with users and search engines.
Full WHOIS record βHow much is easysw.com worth?
easysw.com has an estimated value of $11,233 based on its traffic volume, global ranking, and projected advertising revenue.
How much traffic does easysw.com get?
easysw.com receives approximately 12 unique visitors per day. Its global traffic rank is #623,188.
Is easysw.com safe to visit?
easysw.com uses HTTPS encryption and has an active SSL certificate, which is a positive indicator of security. Always exercise caution when entering personal information on any website.
Where is easysw.com hosted?
The servers for easysw.com are located in United States.
Who owns easysw.com?
Ownership details for easysw.com can be found in the WHOIS section below. Many domain owners use privacy protection services to keep their registration details private.
How does easysw.com rank compared to other .com websites?
With a global rank of #623,188, easysw.com is a recognized .com domain.
| Domain | easysw.com |
| TLD | .com |
| SSL | Secure |
| Server Location | United States |
| Global Rank | #623,188 |
| Registrar | Name.com, Inc. |
| Domain Age | 1995-01-10 05:00:00 |
| Title | Easy Software Products |