Kalpesh.com โ Website Analysis
Comprehensive traffic, valuation, and technical report for kalpesh.com
kalpesh.com does not currently appear in the top 1 million websites by traffic. Limited data is available, but the domain has an estimated value of $0 based on available signals.
The site runs on a .com (commercial) domain with primary IP address 162.159.24.117.
kalpesh.com was first registered on 2000-02-12 through Register.com - Network Solutions, LLC.
Users commonly reach kalpesh.com by searching for "kalpeshwar mahadev", "kalpeshwar", "kalpesh", "kalpeshwar temple", "kalpesh patel".
People searching for these terms often visit kalpesh.com:
kalpeshwar mahadevkalpeshwarkalpeshkalpeshwar templekalpesh patelkalpesh mehtakalpesh shahkalpeshwar mahadev templekalpeshwar trekkalpeshwar mahadev mandir| SSL Certificate | Not Detected |
| Security Score | 0% |
| Strict-Transport-Security | โ |
| Content-Security-Policy | โ |
| X-Content-Type-Options | โ |
| X-Frame-Options | โ |
| X-XSS-Protection | โ |
Based on our analysis, kalpesh.com does not appear to use HTTPS and scores 0% on security headers. There is room for improvement in security configuration.
kalpesh.com is missing 5 of 5 recommended security headers (Strict-Transport-Security, Content-Security-Policy, X-Content-Type-Options, X-Frame-Options, X-XSS-Protection). This leaves visitors more exposed to browser-based attacks.
| Purchase/Sale Value | $0 |
| Daily Revenue | $0 |
| Monthly Revenue | $0 |
| Yearly Revenue | $0 |
| Daily Visitors | 0 |
All values are estimates based on publicly available traffic data.
| Website | kalpesh.com |
| Domain Age | 2000-02-12 20:34:01 |
| TLD | .com |
| Hosting Location | Unknown |
| Primary IP | 162.159.24.117 |
Registered in 2000, kalpesh.com is a veteran domain at 26+ years old. Long-established domains carry more trust with users and search engines.
kalpesh.com uses kalpeshwar mahadev, kalpeshwar, kalpesh, kalpeshwar temple, kalpesh patel in its technology stack.
| Host | Type | IP | Nameserver |
|---|---|---|---|
| kalpesh.com | A | 162.159.24.117 | dns101.register.com. |
| kalpesh.com | A | 162.159.25.158 | dns102.register.com. |
| Registrar | Register.com - Network Solutions, LLC |
| Registered | 2000-02-12 20:34:01 |
| Status | Active |
Registered in 2000, kalpesh.com is a veteran domain at 26+ years old. Long-established domains carry more trust with users and search engines.
Full WHOIS record โHow much is kalpesh.com worth?
kalpesh.com has an estimated value of $0 based on its traffic volume, global ranking, and projected advertising revenue.
How much traffic does kalpesh.com get?
kalpesh.com receives approximately 0 unique visitors per day. Its global traffic rank is #more than 1,000,000.
Is kalpesh.com safe to visit?
kalpesh.com does not appear to have HTTPS enabled, which may be a concern. Always exercise caution when entering personal information on any website.
Where is kalpesh.com hosted?
The hosting location for kalpesh.com could not be determined from available data.
Who owns kalpesh.com?
Ownership details for kalpesh.com can be found in the WHOIS section below. Many domain owners use privacy protection services to keep their registration details private.
| Domain | kalpesh.com |
| TLD | .com |
| SSL | Not Detected |
| Server Location | Unknown |
| Global Rank | #more than 1,000,000 |
| Registrar | Register.com - Network Solutions, LLC |
| Domain Age | 2000-02-12 20:34:01 |