- Estimated worth: $0
- Daily visitors: 0
- Global rank: #more than 1,000,000 out of 1,000,000 tracked websites
- Daily revenue: $0
- Domain age: 2020-03-12 18:22:31
- SSL: Not detected
- Hosted in: United States
Source: Statvoo analysis of weldra.com, updated Jul 2026. Methodology
weldra.com does not currently appear in the top 1 million websites by traffic. Limited data is available, but the domain has an estimated value of $0 based on available signals.
The site runs on a .com (commercial) domain with servers located in United States, primary IP address 54.234.103.190. Its homepage is titled βJust a moment...β.
weldra.com was first registered on 2020-03-12 through TurnCommerce, Inc. DBA NameBright.com.
Users commonly reach weldra.com by searching for "weldracing", "weldrake pharmacy", "weldrack", "weldra", "wheldrake".
People searching for these terms often visit weldra.com:
weldracingweldrake pharmacyweldrackweldrawheldrakewheldrakes yorkweldermwheldrake woodsweld racing wheelswheldrake ings| SSL Certificate | Not Detected |
| Security Score | 0% |
| Strict-Transport-Security | β |
| Content-Security-Policy | β |
| X-Content-Type-Options | β |
| X-Frame-Options | β |
| X-XSS-Protection | β |
Based on our analysis, weldra.com does not appear to use HTTPS and scores 0% on security headers. There is room for improvement in security configuration.
weldra.com is missing 5 of 5 recommended security headers (Strict-Transport-Security, Content-Security-Policy, X-Content-Type-Options, X-Frame-Options, X-XSS-Protection). This leaves visitors more exposed to browser-based attacks.
| Purchase/Sale Value | $0 |
| Daily Revenue | $0 |
| Monthly Revenue | $0 |
| Yearly Revenue | $0 |
| Daily Visitors | 0 |
All values are estimates based on publicly available traffic data.
| Website | weldra.com |
| Domain Age | 2020-03-12 18:22:31 |
| TLD | .com |
| Hosting Location | United States |
| Primary IP | 54.234.103.190 |
Hosted in the United States, weldra.com benefits from low latency for North American visitors and proximity to major internet exchange points.
Registered in 2020, weldra.com has been active for 6 years β past the critical early period where most domains get abandoned.
These technologies were detected from weldra.com's HTTP response headers.
| Host | Type | IP | Nameserver |
|---|---|---|---|
| weldra.com | A | 54.234.103.190 | nsg1.namebrightdns.com. |
| weldra.com | A | 54.162.235.48 | nsg1.namebrightdns.com. |
| weldra.com | A | 54.225.33.252 | nsg1.namebrightdns.com. |
| weldra.com | A | 54.225.31.228 | nsg2.namebrightdns.com. |
| weldra.com | A | 54.221.37.2 | nsg2.namebrightdns.com. |
| weldra.com | A | 3.90.140.102 | nsg2.namebrightdns.com. |
Content-Type
Date
Server
| Registrar | TurnCommerce, Inc. DBA NameBright.com |
| Registered | 2020-03-12 18:22:31 |
| Status | Active |
Registered in 2020, weldra.com has been active for 6 years β past the critical early period where most domains get abandoned.
Full WHOIS record βHow much is weldra.com worth?
weldra.com has an estimated value of $0 based on its traffic volume, global ranking, and projected advertising revenue.
How much traffic does weldra.com get?
weldra.com receives approximately 0 unique visitors per day. Its global traffic rank is #more than 1,000,000.
Is weldra.com safe to visit?
weldra.com does not appear to have HTTPS enabled, which may be a concern. Always exercise caution when entering personal information on any website.
Where is weldra.com hosted?
The servers for weldra.com are located in United States.
Who owns weldra.com?
Ownership details for weldra.com can be found in the WHOIS section below. Many domain owners use privacy protection services to keep their registration details private.
| Domain | weldra.com |
| TLD | .com |
| SSL | Not Detected |
| Server Location | United States |
| Global Rank | #more than 1,000,000 |
| Registrar | TurnCommerce, Inc. DBA NameBright.com |
| Domain Age | 2020-03-12 18:22:31 |
| Title | Just a moment... |